PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000267869
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NF-YB
Protein Properties Length: 293aa    MW: 32029.5 Da    PI: 6.9939
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000267869genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.61e-5484180197
          NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                    vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yre+ege
  MDP0000267869  84 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYREMEGE 179
                    69*********************************************************************************************9 PP

          NF-YB  97 k 97 
                    +
  MDP0000267869 180 R 180
                    7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-5179191IPR009072Histone-fold
SuperFamilySSF471132.33E-3887184IPR009072Histone-fold
PfamPF008087.5E-2690154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-16118136No hitNo description
PROSITE patternPS006850121137IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.9E-16137155No hitNo description
PRINTSPR006151.9E-16156174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MXCKYYSIFT IICVLIYYLR VHAGLKLSDI NVRPAEIXXY SMGMGRQTTT TTNVNNVVNX  60
RNVNHSSSNA NTXNGTADDN ECMVREQDRF MPIANVIRIM RKILPPHAKI SDDAKETIQE  120
CVSEYISFIT GEANERCQRE QRKTITAEDV LWAMSKLGFD DYIEPLTLYL HRYREMEGER  180
GSSTTSLMRS ESLAKGAGXS SGTSSRAIDH HXYYGTSMAA VAAAFHHQHG HGFFGYMNPS  240
DALVSNNXVN AASAAAASGS STQLQGGGSA AMLNGEHHQL PHANGANXAN GGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-4085175393NF-YB
4awl_B4e-4085175494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-4085175494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008384182.10.0PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotQ84W662e-71NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLD7SZ495e-78D7SZ49_VITVI; Putative uncharacterized protein
STRINGVIT_00s0956g00020.t011e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.25e-68nuclear factor Y, subunit B6